The Most Mind-Boggling Lengths Around the World

(contd.)

Page 2 of 2 | «Prev12 Next

NUNATHLOOGAGAMIUTBINGOI

According to The Book of Names written by J.N.Hook, this Eskimo name is used to name some dunes found in Alaska.

Krungtheomahanakornbowornratanakosinmahintarayudhy-aamahadilokpopnoparatanarajthaniburiromudomrajniwesm-ahasatarnamornpimarnavatarsatitsakattiyavisanukam

This is the world's longest name found in Thailand ever declared by the World Meteorological Organization (WMO). It's not surprising to find that not only local people but also foreigners could hardly memorise this long place name. It is later referred to the local as Krung Thep, or in English it translates Jewelled City of the God Indra. This is a qualified Thai name for Bangkok city, as the above long name describes Bangkok as a city of God Indra, the grand capital of the world endowed with nine precious gems, the happy city, abounding in an enormous Royal Palace that resembles the heavenly abode where reigns the reincarnated god, a city given by Indra and built by Visnukarn (Vishwakarma, the builder for the Hindu Gods.)

This hilariously long place name is a combination of the words krungthep mahanakorn (The great city of angels), amorn rattanakosin mahintara yutthaya mahadilok phop (the supreme unconqueralble land of the great immortal divinity (Indra), noparat rajathani burirom (the royal capital of nine noble gems, the pleasant city), udomrajaniwes mahasatharn (with plenty of grand royal palaces), amorn phimarn avatarnsathit (and divine paradises for the reincarnated deity [Vishnu] ), sakkatattiya visanukam prasit (given by Indra and created by the god of crafting [Visnukarma] ). This is a name given by King Rama I, the founder of the city in a celebration to the new capital after Sukhothai, Thonburi and Ayudhaya 219 years ago. But, it was said by Theppitak Karoonboonyanan that the 163-letter of Krung¬thep¬maha¬nakorn¬amorn¬ratana¬kosin¬mahintar¬ayutthay¬amaha¬dilok¬phop¬noppa¬ratrajathani¬burirom¬udom¬raj-aniwes¬mahasat¬harn¬amorn¬phimarn¬avatarn¬sathit¬sakkattiya¬visanukamprasit will be its appropriate correct spelling.

Puzzle

This fun, additive, challenging and mind-blending puzzle riddle is by far the longest puzzle ever created. It consists of 200 levels. Not only it is the longest, but also it is the hardest to solve. Out of 6,000 people who attempted to solve it, only 11 out of them have made their ways to pass through its 100 levels. No one in this world has solved it up to 200 levels. This timtangtest requires the combination skills of maths, music, and of course your patience and perseverance to get it solved. Before starting this test, you should attend its tutorial and read its homepage carefully to understand the purpose and mechanism of the test.

Domain Name

Some companies prefer to register a relatively long domain name for the purpose of a publicity stunt and media attraction as well. However, this long domain name does not help the visitors to memorise the selected domain name perfectly. Below are longer domain names ever registered.

lerelaisinternet-com-favorise-la-croissance-de-votre-entreprise.eu.

This long domain name was registered by a French company in French with the aims to facilitate the growth of its business.

3.141592653589793238462643383279502884197169399375105820974944592.com

This domain name has the first 65 characters of the value of Pi to one million decimal places. It was registered by a German technology company.

aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa.eu zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz.eu

Both of these domain names were generated with all its characters in the same alphabet.

Escalator


Photo credit: David Astley

This is one of the escalators found in Pyongyang's metro in North Korea. It seems that it will go on as far as you could see its end. This escalator goes down to the station platform.


Image source

This is the escalator found in Umeda Sky Building, the tallest building in Osaka City, Japan. This building consists of two 40 story towers and is situated in the Umeda district of Kitaku in Osaka, Japan. This escalator is the longest in Japan.

Epic

“King Gesser” is the world's longest epic that is still passed down from generation to generation for a thousand year in Qinghai Province and Tibetan Autonomous Region in western China. This epic contains 10 million words and more than 200 parts. It tells the story of the ancient Tibetan King who conquered the devils of other Tibetan tribes.

Beach


Photo credit: Smith

This is the world's longest freshwater beach with its length about eight and a half miles. It is a Wasaga beach in Canada. The visitors can enjoy hiking and boating here.


Photo credit: Michael Tim

This beach is always claimed as the world's longest beach. This thirty-mile-long beach is the Long Beach of Washington. It is ranked as the longest beach on the United States' West Coast.


Photo credit: Jongtu

With its over 150 miles long beach, Praia do Cassino Beach in Brazil, is by far the longest beach in the world. It is famous for its warm temperature, and pure white sand. Surfing is the most popular pastime here.


Photo credit: Mohammed

This is Cox's Bazar Beach of Bangladesh. It is the world's longest natural sand beach which stretches across 150 miles. The local people call this beach “Panowa”, or in English it translates “little flower.”

Joke

This is the world's longest joke ever created. The joke is given a title as “Lost in The Desert”. Since it is terribly long, I leave its link here. Have fun reading this joke!

Song

Supercalifragilisticexpialidocious is an English song in the musical film of Mary Poppins. Its song was written by the Sherman Brothers, and sung by Dick van Dyke and Julie Andrews.

Railroad


Image source

The Trans-Siberian Railroad is regarded as the world's longest railroad. From Moscow, its eastern terminus in Vladivostok is 9289km or 5,772 miles.

Page 2 of 2 | «Prev12 Next
12 Liked It
I Like It!
Related Articles
30+ Stunning Facts About Natural Phenomena
21 Simply Amazing Random Facts
Comments (8)
#1 by Balzac
Aug 24, 2008
Thank you for the tour.
#2 by Claris
Aug 24, 2008
nice article, thanks for sharing
#3 by IcyCucky
Aug 24, 2008
This will be another hot hit, Chan! Very informative..
#4 by Lauren Axelrod
Aug 24, 2008
Interesting. Good article
#5 by nobert soloria bermosa
Aug 24, 2008
that was really long,thanks
#6 by Judy Sheldon
Aug 24, 2008
Fascinating article. You must have went to long lengths to create it. lol
#7 by Alexa Gatesq
Aug 24, 2008
very interesting!
#8 by Lostash
Aug 26, 2008
Aren't names great!
Post Your Comment:
Name:  
Copy the code into this box:  
Post comment with your Triond credentials?

Popular Tags
Powered by
Inside PurpleSlinky

Humor

Jokes

Offbeat

Trivia

Popular Writers
PurpleSlinky
About Us
Terms of Use
Privacy Policy
Services
Submit an Article
Advertise with Us
Contact
© 2007 Copyright Stanza Ltd. All Rights Reserved.